Last Updated: June 25, 2026

Claims for Patent: 10,035,843


✉ Email this page to a colleague

« Back to Dashboard


Summary for Patent: 10,035,843
Title:RSV-specific binding molecule
Abstract: The invention provides antibodies and functional equivalents thereof which are capable of specifically binding RSV. Nucleic acid sequences encoding said antibody, as well as antibody producing cells and methods for producing said antibody are also provided.
Inventor(s): Beaumont; Tim (Ouderkerk aan de Amstel, NL), Bakker; Adrianus Q. (Hoorn, NL), Yasuda; Etsuko (Amsterdam, NL)
Assignee: MedImmune Limited (Cambridge, GB)
Application Number:15/042,656
Patent Claims:1. A method for treating and/or preventing a RSV-related disorder, the method comprising administering to an individual in need thereof a therapeutically effective amount of an antibody, or functional part thereof, wherein the antibody or functional part thereof specifically binds to a Respiratory Syncytial Virus (RSV) F protein and comprises: a heavy chain CDR1 sequence comprising the sequence KLSIH (SEQ ID NO:4), a heavy chain CDR2 sequence comprising the sequence GYEGEVDEIFYAQKFQH (SEQ ID NO:8), a heavy chain CDR3 sequence comprising the sequence LGVTVTEAGLGIDDY (SEQ ID NO:12), a light chain CDR1 sequence comprising the sequence RASQIVSRNHLA (SEQ ID NO:20), a light chain CDR2 sequence comprising the sequence GASSRAT (SEQ ID NO:24), and a light chain CDR3 sequence comprising the sequence LSSDSSI (SEQ ID NO:28).

2. The method of claim 1, the antibody or functional part thereof having a heavy chain sequence comprising a sequence which is at least 70% identical to the sequence TABLE-US-00008 (SEQ ID NO: 16) QVQLVQSGAEVKKPGATVKVSCKISGHTLIKLSIHWVRQAPGKGLEWMGG YEGEVDEIFYAQKFQHRLTVIADTATDTVYMELGRLTSDDTAVYFCGTLG VTVTEAGLGIDDYWGQGTLVTVSS

and/or having a light chain sequence which is at least 70% identical to the sequence TABLE-US-00009 (SEQ ID NO: 32) EIVLTQSPGTLSLSPGERATLSCRASQIVSRNHLAWYQQKPGQAPRLLIF GASSRATGIPVRFSGSGSGTDFTLTINGLAPEDFAVYYCLSSDSSIFTFG PGTKVDFK.

3. The method of claim 1, wherein the antibody, or functional part thereof, comprises an IgG1 heavy chain.

4. The method of claim 1, wherein the antibody, or functional part thereof, comprises a Fc region comprising a modification at one or more positions selected from the group consisting of 234, 235, 236, 237, 238, 239, 240, 241, 243, 244, 245, 247, 251, 252, 254, 255, 256, 262, 263, 264, 265, 266, 267, 268, 269, 279, 280, 284, 292, 296, 297, 298, 299, 305, 313, 316, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 339, 341, 343, 370, 373, 378, 392, 416, 419, 421, 440 and 443 as numbered by the EU index of Kabat, said modification comprising an amino acid substitution, and/or an amino acid insertion, and/or an amino acid deletion.

5. The method of claim 4, wherein the Fc region modification comprises amino acid substitutions at amino acid positions 252, 254, and/or 256.

6. The method of claim 5, wherein the amino acid substitution at amino acid position 252 is a substitution with tyrosine, the amino acid substitution at amino acid position 254 is a substitution with threonine, and/or the amino acid substitution at amino acid position 256 is a substitution with glutamic acid.

7. The method of claim 1, wherein the antibody or functional part thereof is administered to the individual before infection with RSV.

8. The method of claim 1, wherein the antibody or functional part thereof is administered to the individual after infection with RSV.

9. The method of claim 1, wherein the individual is at an increased risk of complications from an RSV infection.

10. The method of claim 9, wherein an increased risk of complications from an RSV infection comprises premature birth, otherwise healthy but younger than six weeks of age, elderly, chronic lung disease, congenital heart disease, hospitalized, or with compromised immunity.

11. The method of claim 1 further comprising administering palivizumab, AM14, AM16, AM23, and/or D25.

12. The method of claim 1, further comprising administering at least one other RSV-specific antibody.

13. The method of claim 1, wherein the antibody or functional part thereof comprises: a heavy chain sequence comprising the amino acid sequence of SEQ ID NO:16; or a light chain sequence comprising the amino acid sequence of SEQ ID NO:32; or a heavy chain sequence comprising the amino acid sequence of SEQ ID NO:16 and a light chain sequence comprising the amino acid sequence of SEQ ID NO:32.

14. The method of claim 1, wherein the antibody or functional part thereof comprises a humanized antibody.

15. The method of claim 1, wherein the antibody or functional part thereof comprises a human antibody.

16. The method of claim 1, wherein the antibody or functional part thereof comprises a human IgG1 heavy chain.

17. The method of claim 13, wherein the antibody or functional part thereof comprises a human IgG1 heavy chain.

18. The method of claim 17, wherein the antibody, or functional part thereof, comprises a Fc region comprising a modification at one or more positions selected from the group consisting of 234, 235, 236, 237, 238, 239, 240, 241, 243, 244, 245, 247, 251, 252, 254, 255, 256, 262, 263, 264, 265, 266, 267, 268, 269, 279, 280, 284, 292, 296, 297, 298, 299, 305, 313, 316, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 339, 341, 343, 370, 373, 378, 392, 416, 419, 421, 440 and 443 as numbered by the EU index of Kabat, said modification comprising an amino acid substitution, and/or an amino acid insertion, and/or an amino acid deletion.

19. The method of claim 18, wherein the Fc region modification comprises amino acid substitutions at amino acid positions 252, 254, and/or 256.

20. The method of claim 19, wherein the amino acid substitution at amino acid position 252 is a substitution with tyrosine, the amino acid substitution at amino acid position 254 is a substitution with threonine, and/or the amino acid substitution at amino acid position 256 is a substitution with glutamic acid.

Details for Patent 10,035,843

Applicant Tradename Biologic Ingredient Dosage Form BLA Approval Date Patent No. Expiredate
Swedish Orphan Biovitrum Ab (publ) SYNAGIS palivizumab For Injection 103770 June 19, 1998 ⤷  Start Trial 2036-02-12
Swedish Orphan Biovitrum Ab (publ) SYNAGIS palivizumab Injection 103770 July 23, 2004 ⤷  Start Trial 2036-02-12
>Applicant >Tradename >Biologic Ingredient >Dosage Form >BLA >Approval Date >Patent No. >Expiredate

Make Better Decisions: Try a trial or see plans & pricing

Drugs may be covered by multiple patents or regulatory protections. All trademarks and applicant names are the property of their respective owners or licensors. Although great care is taken in the proper and correct provision of this service, thinkBiotech LLC does not accept any responsibility for possible consequences of errors or omissions in the provided data. The data presented herein is for information purposes only. There is no warranty that the data contained herein is error free. We do not provide individual investment advice. This service is not registered with any financial regulatory agency. The information we publish is educational only and based on our opinions plus our models. By using DrugPatentWatch you acknowledge that we do not provide personalized recommendations or advice. thinkBiotech performs no independent verification of facts as provided by public sources nor are attempts made to provide legal or investing advice. Any reliance on data provided herein is done solely at the discretion of the user. Users of this service are advised to seek professional advice and independent confirmation before considering acting on any of the provided information. thinkBiotech LLC reserves the right to amend, extend or withdraw any part or all of the offered service without notice.