Claims for Patent: 8,398,976

Summary for Patent: 8,398,976

Title:	Antibodies to EGFL7 and methods for their use
Abstract:	The invention provides anti-EGFL7 antibodies, and compositions comprising and methods of using these antibodies.
Inventor(s):	Ye; Weilan (Foster City, CA), Schmidt; Maike (San Francisco, CA), Hongo; Jo-Anne (Redwood City, CA), Wu; Yan (Foster City, CA)
Assignee:	Genentech, Inc. (South San Francisco, CA)
Application Number:	13/087,247
Patent Claims:	1. An anti-EGFL7 antibody produced by a hybridoma selected from the group consisting of anti-EGFL7 mumab 4F11.1.8, anti-EGFL7 mumab 10G9.1.6, and anti-EGFL7 mumab 18F7.1.8. 2. An anti-EGFL7 antibody which comprises the following six complementarity determining regions (CDRs): TABLE-US-00009 (SEQ ID NO: 5) (a) 4F11 CDR-L1 sequence KASQSVDYDGDSYMS; (SEQ ID NO: 6) (b) 4F11 CDR-L2 sequence GASNLES; (SEQ ID NO: 7) (c) 4F11 CDR-L3 sequence QQNNEDPYT; (SEQ ID NO: 8) (d) 4F11 CDR-H1 sequence TYGMS; (SEQ ID NO: 9) (e) 4F11 CDR-H2 sequence WINTHSGVPTYADDFKG; and (SEQ ID NO: 10) (f) 4F11 CDR-H3 sequence LGSSA. 3. The anti-EGFL7 antibody of claim 2, wherein the light chain of said antibody comprises the sequence: TABLE-US-00010 (SEQ ID NO: 1) DIVLTQSPASLAVSLGQRATISCKASQSVDYDGDSYMSWYQQKPGQPPKL LIYGASNLESGIPARFSGSGSGTDFTLNIHPVEEEDAATYYCQQNNEDPY TFGGGTKVEIKR. 4. The anti-EGFL7 antibody of claim 2 or 3, wherein the heavy chain of said antibody comprises the sequence: TABLE-US-00011 (SEQ ID NO: 2) QIQLVQSGPELKKPGETVKISCKASGHTFTTYGMSWVKQAPGKGLKWMGW INTHSGVPTYADDFKGRFAFSLETSASTAHLQINNLKNEDTATYFCARLG SSAVDYWGQGTTVTVSS. 5. An anti-EGFL7 antibody which comprises the following six complementarity determining regions (CDRs): TABLE-US-00012 (SEQ ID NO: 11) (a) 10G9 CDR-L1 sequence RSSQSLVHTNGITYLH; (SEQ ID NO: 12) (b) 10G9 CDR-L2 sequence KVSNRFS; (SEQ ID NO: 13) (c) 10G9 CDR-L3 sequence SQSTHVPLT; (SEQ ID NO: 14) (d) 10G9 CDR-H1 sequence DYYMNSDYYMN; (SEQ ID NO: 15) (e) 10G9 CDR-H2 sequence DINPKNGGTTYNQKFKG; and (SEQ ID NO: 16) (f) 10G9 CDR-H3 sequence ALGVFDY. 6. The anti-EGFL7 antibody of claim 5, wherein the light chain of said antibody comprises the sequence: TABLE-US-00013 (SEQ ID NO: 3) DIVMTQTPLSLPVSLGDQASISCRSSQSLVHTNGITYLHWYLQKPGQSPK LLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVP LTFGAGTKVEIKR. 7. The anti-EGFL7 antibody of claim 5 or 6, wherein the heavy chain of said antibody comprises the sequence: TABLE-US-00014 (SEQ ID NO: 4) EVQLQQSGPELVKPGASVKISCKASGYTFSDYYMNSDYYMNWVKQSHGKS LEWIGDINPKNGGTTYNQKFKGKATLTVDKSSSTAYMELRSLTSEDSAVY YCAREADYDPIYYAMDYWGQGTTLTVSA. 8. An isolated anti-EGFL7 antibody that specifically binds EGFL7 at an epitope in the amino acid sequence RACSTYRTIYRTA (SEQ ID NO: 31). 9. An isolated anti-EGFL7 antibody that binds to the same epitope on human EGFL7 as the antibody of claim 1. 10. An isolated anti-EGFL7 antibody that competes for EGFL7 binding with the antibody of claim 1. 11. An isolated anti-EGFL7 antibody that specifically binds EGFL7 at an epitope in the amino acid sequence RPRYACCPGWKRT (SEQ ID NO: 28). 12. The antibody of any one of claims 1, 2, 5, 8, 9, 10, or 11, wherein the antibody is a monoclonal antibody. 13. The antibody of claim 1, 2, 5, 8, 9, 10, or 11, wherein the antibody is selected from the group consisting of a chimeric antibody, a humanized antibody, an affinity matured antibody, a human antibody, a multivalent antibody, and a bispecific antibody. 14. The antibody of any one of claim 1, 2, 5, 8, 9, 10, or 11, wherein the antibody is an antigen-binding antibody fragment. 15. A pharmaceutical composition comprising: (a) an anti-EGFL7 antibody of claim 1, 2, 5, 8, or 11; or (b) an isolated anti-EGFL7 antibody of claim 9 or 10. 16. The pharmaceutical composition of claim 15, further comprising an anti-angiogenic agent. 17. The pharmaceutical composition of claim 16, wherein the anti-angiogenic agent is selected from the group consisting of bevacizumab and ranibizumab. 18. A method for reducing or inhibiting angiogenesis in a subject having a pathological condition associated with angiogenesis, comprising administering to the subject an effective amount of the pharmaceutical composition of claim 15. 19. The method of claim 18, wherein the pathological condition is a neoplasm. 20. The method of claim 19, wherein the neoplasm is a carcinoma. 21. The method of claim 18, wherein the pathological condition is associated with the eye. 22. The method of claim 21, wherein the pathological condition is an intraocular neovascular disease. 23. The method of claim 18, further comprising administering to the subject an anti-angiogenic agent. 24. The method of claim 23, wherein the anti-angiogenic agent is an antagonist of vascular endothelial growth factor (VEGF). 25. The method of claim 24, wherein the antagonist is an anti-VEGF antibody. 26. The method of claim 25, wherein the anti-VEGF antibody is bevacizumab. 27. The method of claim 21, further comprising administering to the subject an anti-angiogenic agent. 28. The method of claim 27, wherein the anti-angiogenic agent is an antagonist of vascular endothelial growth factor (VEGF). 29. The method of claim 28, wherein the antagonist is an anti-VEGF antibody. 30. The method of claim 29, wherein the anti-VEGF antibody is ranibizumab. 31. The method of claim 23, wherein the anti-angiogenic agent is administered prior to or subsequent to the administration of the anti-EGFL7 antibody. 32. The method of claim 23, wherein the anti-angiogenic agent is administered concurrently with the anti-EGFL7 antibody. 33. A method of enhancing the efficacy of an anti-angiogenic agent in a subject having a pathological condition associated with angiogenesis, comprising administering to the subject the pharmaceutical composition of claim 15. 34. The method of claim 23, wherein the pathological condition is a neoplasm. 35. The method of claim 24, wherein the neoplasm is a carcinoma. 36. The method of claim 33, wherein the anti-antigenic agent is bevacizumab. 37. The method of claim 33, further comprising administering a chemotherapeutic agent. 38. The method of claim 33, wherein the pathological condition is associated with the eye. 39. The method of claim 38, wherein the pathological condition is an intraocular neovascular disease. 40. The method of claim 38, wherein the anti-angiogenic agent is ranibizumab. 41. The method of claim 38, further comprising administering a corticosteroid. 42. The method of claim 38, further comprising administering photodynamic therapy. 43. The antibody of claim 14, wherein the fragment is an Fab, Fab', Fab'-SH, F(ab).sub.2, or scFv fragment. 44. The isolated anti-EGFL7 antibody of claim 9 or 10, wherein the antibody of claim 1 is mumab 4F11.1.8. 45. The isolated anti-EGFL7 antibody of claim 9 or 10, wherein the antibody of claim 1 is mumab 10G9.1.6. 46. The isolated anti-EGFL7 antibody of claim 9 or 10, wherein the antibody of claim 1 is mumab 18F7.1.8. 47. The pharmaceutical composition of claim 17, wherein the anti-angiogenic agent is bevacizumab. 48. The method of claim 18, further comprising administering to the subject a chemotherapeutic agent. 49. The method of claim 48, wherein the chemotherapeutic agent is FOLFOX. 50. The method of claim 48, wherein the chemotherapeutic agent is carboplatin and paclitaxel. 51. The method of claim 19, wherein the neoplasm is colorectal cancer. 52. The method of claim 19, wherein the neoplasm is non-small cell lung cancer. 53. The method of claim 33, further comprising administering to the subject a chemotherapeutic agent. 54. The method of claim 53, wherein the chemotherapeutic agent is FOLFOX. 55. The method of claim 53, wherein the chemotherapeutic agent is carboplatin and paclitaxel. 56. The method of claim 34, wherein the neoplasm is colorectal cancer. 57. The method of claim 34, wherein the neoplasm is non-small cell lung cancer.

Details for Patent 8,398,976

Applicant	Tradename	Biologic Ingredient	Dosage Form	BLA	Approval Date	Patent No.	Expiredate
Genentech, Inc.	AVASTIN	bevacizumab	Injection	125085	02/26/2004		2026-03-16
Genentech, Inc.	LUCENTIS	ranibizumab	Injection	125156	06/30/2006		2026-03-16
Genentech, Inc.	LUCENTIS	ranibizumab	Injection	125156	08/10/2012		2026-03-16
Genentech, Inc.	LUCENTIS	ranibizumab	Injection	125156	10/13/2016		2026-03-16