Last Updated: September 24, 2026

Details for Patent: 5,674,710


✉ Email this page to a colleague

« Back to Dashboard


Summary for Patent: 5,674,710
Title:Recombinant techniques for production of human brain natriuretic peptide
Abstract:The cDNA sequence encoding porcine brain natriuretic peptide and related genes encoding canine and human peptides with natriuretic activity are disclosed. The gene is shown to make accessible the DNAs encoding analogous natriuretic peptides in other vertebrate species. The genes encoding these NPs can be used to effect modifications of the sequence to produce alternate forms of the NPs and to provide practical amounts of these proteins. The NPs of the invention can also be synthesized chemically.
Inventor(s):J. Jeffrey Seilhamer, John Lewicki, Robert M. Scarborough, J. Gordon Porter
Assignee: Scios LLC
Application Number:US07/477,226
Patent Claim Types:
see list of patent claims
Use;
Patent landscape, scope, and claims:

US Patent 5,674,710: Claim Scope, Expiration, Orange Book Status, and Nesiritide Patent Landscape

US Patent 5,674,710 covers recombinant DNA constructs, expression systems, host cells, and production methods for natriuretic peptides corresponding principally to human brain natriuretic peptide, or BNP. Its narrowest and commercially important embodiment is recombinant human BNP-32, the active ingredient in Natrecor, also known as nesiritide.

The patent issued on October 7, 1997, and its 17-year patent term expired on October 7, 2014, subject to any recorded term adjustment. It therefore presents no current patent barrier to generic or alternative production of nesiritide. The claims do not cover nesiritide formulations, therapeutic use, dosing regimens, or the manufacture of the finished drug product independently of the claimed recombinant production technology. [1]

What invention does US Patent 5,674,710 protect?

The patent protects the recombinant production of natriuretic peptides having the core sequence:

Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys

This sequence corresponds to the central ring-forming region of human BNP. The cysteine residues support the disulfide-bonded structure associated with natriuretic activity.

The claims also cover selected amino-terminal and carboxy-terminal extensions. The principal sequence combinations include:

Component Claimed sequence options Functional significance
Core peptide CFGRKMDRISSSSGLGC Conserved BNP natriuretic core
N-terminal extensions Hydrogen, Gly, Ser-Gly, Gly-Ser-Gly, Gln-Gly-Ser-Gly, and longer sequences Covers truncated, mature, and precursor-associated forms
Full N-terminal extension SPKMVQGSG- Corresponds to the amino-terminal region of human BNP-32
C-terminal extensions Hydroxyl, Lys, Lys-Val, Lys-Val-Leu, Lys-Val-Leu-Arg, Lys-Val-Leu-Arg-Lys, Lys-Val-Leu-Arg-Lys-His Covers mature and processed BNP forms
Commercially relevant peptide SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH Human BNP-32, or nesiritide

The full BNP-32 sequence identified by the dependent claims is:

Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His

The claims are directed to recombinant production rather than to a product defined only by its amino-acid sequence.

How many independent claims does US 5,674,710 contain?

The patent has four independent claims:

Claim Protected subject matter Claim type
1 Isolated and purified recombinant DNA encoding the specified natriuretic peptide Product
2 Recombinant expression system capable of expressing the peptide-encoding DNA Functional biological system
3 Recombinant host cell or cell culture containing the expression system Biological material
4 Method of producing the peptide by culturing the host cells and recovering the peptide Manufacturing method

Claims 5 through 8 narrow those categories to the specific BNP-32 sequence with:

  • N-terminal sequence: Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-
  • C-terminal sequence: Lys-Val-Leu-Arg-Lys-His

Claims 5 and 8 are especially important because they capture the recombinant expression system and DNA encoding the 32-amino-acid human BNP sequence associated with nesiritide.

What is the scope of claim 1?

Claim 1 covers an isolated and purified recombinant DNA that encodes a peptide with the claimed natriuretic sequence architecture.

The claim has four material limitations:

  1. The DNA must be recombinant.
  2. It must be in isolated and purified form.
  3. It must encode a peptide having natriuretic activity.
  4. The encoded peptide must contain the specified BNP-related core sequence and one of the enumerated terminal structures.

The phrase “consisting essentially of” limits the claim to DNA whose additional sequence content does not materially alter the claimed natriuretic peptide encoding function. It does not necessarily require the DNA molecule to contain only the coding sequence and nothing else. However, DNA sequences that encode materially different peptides, unrelated signal sequences, or non-BNP natriuretic factors would fall outside the literal sequence definition.

Claim 1 is broader than claim 8 because it covers multiple N-terminal and C-terminal variants. It is narrower than a general claim to any DNA encoding BNP, any natriuretic peptide, or any recombinant peptide with BNP-like activity.

What is the scope of claims 2 and 3?

Claim 2: Recombinant expression systems

Claim 2 covers an expression system capable of expressing DNA encoding the claimed peptide when present in a recombinant host cell.

The claim is functional. It does not require one particular promoter, plasmid, vector, codon sequence, host species, or secretion signal. A qualifying system could therefore use different molecular components, provided the system is capable of expressing a DNA sequence encoding the claimed peptide.

Potentially relevant expression platforms include:

  • Bacterial expression systems;
  • Yeast systems;
  • Mammalian cell systems;
  • Plasmid-based systems;
  • Integrated genomic constructs;
  • Systems using intracellular expression followed by recovery;
  • Systems using secretion or precursor processing.

The claim remains limited by the peptide sequence and the requirement that the system be capable of expression in a recombinant host cell.

Claim 3: Recombinant host cells

Claim 3 covers a recombinant host cell or cell culture containing the expression system of claim 2.

The claim is cell-platform neutral. It does not expressly require a specific bacterial, fungal, insect, or mammalian host. Infringement would generally turn on whether the host contains an expression system meeting claim 2 and whether the encoded product falls within the claimed peptide structure.

A host that merely contains unrelated BNP DNA without the claimed expression capability would not necessarily meet claim 3. Conversely, a host cell using a different vector or promoter could still fall within the claim if it contains a qualifying expression system.

What is the scope of claim 4?

Claim 4 covers a recombinant manufacturing process with two required steps:

  1. Culturing the claimed recombinant cells under conditions permitting expression; and
  2. Recovering the natriuretic peptide from the culture.

This is a process claim, not a claim to a finished injectable formulation. It reaches production workflows that use a qualifying host cell and recover the peptide from the culture medium or cellular material.

The claim does not expressly recite:

  • Refolding conditions;
  • Proteolytic cleavage;
  • Chromatographic purification;
  • Lyophilization;
  • Sterile filling;
  • Buffer composition;
  • Concentration;
  • Container closure;
  • Administration to a patient.

Those steps may be commercially necessary, but they are not independently required by the text of claim 4. The process must still use the claimed recombinant cell and produce a peptide within the defined sequence scope.

What do claims 5 through 8 protect?

Claims 5 through 8 narrow the patent to the sequence corresponding to human BNP-32.

Claim Narrowed subject matter
5 Recombinant expression system expressing BNP-32
6 Host cell or cell culture containing that system
7 Method of producing BNP-32 by culturing those cells and recovering the peptide
8 Recombinant DNA encoding BNP-32

The specified peptide is:

SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

This is the most direct connection between the patent and nesiritide. The claims do not require the drug to be called nesiritide, Natrecor, or BNP-32. A product meeting the sequence and recombinant-production limitations could fall within the claims regardless of branding.

When did US Patent 5,674,710 expire?

The patent issued on October 7, 1997. For a patent governed by the pre-Uruguay Round 17-year term rule, the ordinary term runs 17 years from issuance. On that basis, the expiration date was October 7, 2014. [1, 5]

Milestone Date
Patent issuance October 7, 1997
Standard 17-year expiration October 7, 2014
Current status Expired
Current blocking effect None from this patent

The patent’s expiration eliminates enforceable exclusion based on claims 1 through 8. It does not eliminate possible rights under later patents covering formulations, manufacturing improvements, purification, dosing, or unrelated therapeutic uses.

What is the Orange Book status of US 5,674,710?

US Patent 5,674,710 was associated with the recombinant BNP technology underlying Natrecor, a recombinant human BNP product approved by FDA under NDA 20-920. FDA approved Natrecor in 2001 for use in certain patients with acute decompensated heart failure. [2, 3]

The relevant regulatory position is:

Regulatory issue Status
Reference product Natrecor, nesiritide
Active ingredient Recombinant human B-type natriuretic peptide
FDA approval pathway NDA
FDA approval date August 10, 2001
Patent relevance Recombinant BNP production
Patent expiration October 7, 2014
Present patent exclusivity None under US 5,674,710

An Orange Book patent listing does not extend the patent term. Once the listed patent expires, it cannot block an otherwise approvable abbreviated application. FDA regulatory exclusivity and patent exclusivity are separate rights. Any five-year new chemical entity exclusivity associated with the 2001 approval would have expired years before the patent. [2, 3]

Are there Paragraph IV challenges to US 5,674,710?

A Paragraph IV certification would have been relevant before October 7, 2014 if an ANDA applicant sought approval for a product referencing Natrecor and challenged the patent as invalid, unenforceable, or not infringed.

The commercial significance of a Paragraph IV challenge has now ended because the patent is expired. A current applicant does not need to defeat an unexpired claim to enter after the patent term. The remaining regulatory issues would concern pharmaceutical equivalence, product quality, analytical characterization, manufacturing controls, and approval of the appropriate application pathway.

There is no continuing 30-month litigation stay attributable to an expired patent. A historical Paragraph IV case, if any, would not restore exclusivity or prevent post-expiration entry.

Does nesiritide have biosimilar risk or generic risk?

Nesiritide presents generic and biologic-like manufacturing issues, but its US approval pathway is important.

Natrecor was approved as an NDA product rather than as a licensed biologic under a BLA. A follow-on applicant would therefore generally evaluate the 505(b)(2) or ANDA pathways rather than assume that the biosimilar pathway under section 351(k) is required.

Entry route Relevance to nesiritide
ANDA under section 505(j) Potentially available if pharmaceutical equivalence and bioequivalence can be demonstrated
505(b)(2) NDA Available where clinical or manufacturing differences require reliance on existing data plus new evidence
351(k) biosimilar application Generally not the primary pathway for an NDA-approved recombinant peptide
Full 505(b)(1) NDA Available but commercially inefficient if sufficient reference-product data exist

The central barrier is not US 5,674,710. The practical barriers are product characterization, potency assays, peptide aggregation, impurities, oxidation, disulfide-bond control, sterility, stability, and comparability of the recombinant manufacturing process.

What formulations are protected by this patent?

US 5,674,710 does not expressly claim:

  • Intravenous dosage forms;
  • Vials;
  • Lyophilized nesiritide;
  • Reconstitution solutions;
  • Specific buffers;
  • Stabilizers;
  • Preservatives;
  • Container systems;
  • Infusion pumps;
  • Concentration ranges;
  • Shelf-life specifications.

The patent covers the recombinant DNA, expression system, host cell, and culture-and-recovery method. A later formulation patent could have provided separate protection, but such protection would need to be evaluated independently from the claims supplied here.

This distinction matters because a manufacturer could avoid an expired recombinant-production patent only in the legal sense that the patent no longer blocks production. It would still need to satisfy FDA requirements for the finished injectable product.

Does the patent cover therapeutic use of nesiritide?

No. The supplied claims do not claim administering BNP-32 to treat heart failure, reducing pulmonary capillary wedge pressure, improving hemodynamics, treating renal dysfunction, or managing any other disease.

The patent also does not claim:

  • A patient population;
  • A dose;
  • An infusion rate;
  • A combination with diuretics;
  • A renal-protection regimen;
  • A method for reducing hospitalization;
  • A diagnostic method using BNP.

Any patent covering those subjects would be a separate method-of-use or treatment patent. The expiration of US 5,674,710 would not automatically establish that every later-use patent had expired.

How strong is the patent estate for nesiritide?

The patent was strong during its enforceable term because it reached multiple layers of recombinant production:

  1. The encoding DNA;
  2. The expression system;
  3. The host cell;
  4. The manufacturing process;
  5. The specific BNP-32 embodiment.

That structure created overlapping protection around the biological production platform. A competitor could potentially avoid one claim category but still encounter another if it used the same BNP sequence and recombinant production architecture.

The estate is weak as a current exclusivity asset because the foundational patent expired in 2014. Its remaining value is historical, evidentiary, and technical rather than exclusionary.

Patent-strength factor Assessment
Sequence coverage Strong for listed BNP variants
BNP-32 coverage Direct and specific
Platform coverage Broad across DNA, vectors, cells, and production
Formulation coverage Not present in the supplied claims
Method-of-use coverage Not present
Current enforceability None after expiration
Manufacturing relevance High historically; no current blocking effect
Design-around burden during term Material
Present licensing value Limited unless tied to separate unexpired rights

Which companies challenged or competed with the patent estate?

The commercial reference product was developed by Scios and later associated with Johnson & Johnson following Johnson & Johnson’s acquisition of Scios. The relevant competitive landscape included:

  • Scios and Johnson & Johnson as the reference-product sponsors;
  • Potential generic peptide manufacturers;
  • Developers of alternative natriuretic peptides;
  • Developers of other acute heart-failure therapies;
  • Companies pursuing formulation or delivery improvements.

The principal product competitors were not necessarily direct BNP sequence competitors. In acute heart failure, competing therapeutic classes included loop diuretics, vasodilators, inotropes, and other hemodynamic agents. Carperitide and ularitide represented alternative natriuretic-peptide programs in non-US or investigational markets, but they were not necessarily covered by the specific BNP sequence claims in US 5,674,710.

What geographic coverage does US 5,674,710 provide?

The patent provides US rights only. It does not, by itself, establish protection in:

  • Europe;
  • Japan;
  • Canada;
  • China;
  • Australia;
  • Other jurisdictions.

Related foreign applications may have been filed from the same priority family, but each jurisdiction required separate prosecution, maintenance, and term analysis. The US expiration date cannot be applied automatically to foreign counterparts.

For international production, a manufacturer would need to evaluate:

  • National-phase counterparts;
  • Local patent expiration dates;
  • Patent-term adjustments or extensions;
  • Supplementary protection certificates;
  • Local formulation patents;
  • Local regulatory exclusivity;
  • Manufacturing location and export rules.

What generic launch scenarios exist after patent expiration?

Three entry scenarios are commercially relevant:

Scenario Description Patent impact
Immediate post-expiration entry Applicant launches after satisfying FDA requirements US 5,674,710 does not block entry
505(b)(2) entry Applicant relies partly on Natrecor data but uses a modified formulation or manufacturing process No live barrier from the patent
No commercial entry Applicant obtains approval but does not launch because of limited market demand or manufacturing cost Commercial, not patent-driven

The principal commercial constraints are likely market size, clinical demand, manufacturing economics, hospital formulary positioning, and the need to establish a reliable quality-control package for a recombinant peptide injectable.

Key Takeaways

  • US Patent 5,674,710 covers recombinant DNA and recombinant production systems for BNP-related natriuretic peptides.
  • Claims 5 through 8 specifically target recombinant human BNP-32, the sequence associated with nesiritide.
  • The patent covers DNA, expression systems, host cells, and culture-and-recovery methods.
  • It does not claim formulations, dosing, therapeutic use, or finished injectable products as such.
  • The patent issued on October 7, 1997, and its ordinary 17-year term expired on October 7, 2014.
  • It creates no current patent barrier to generic or follow-on nesiritide development.
  • Nesiritide was approved by FDA as an NDA product, making 505(j) and 505(b)(2) more relevant than a conventional biosimilar pathway.
  • Current entry risk is driven by manufacturing complexity, analytical comparability, FDA requirements, and market economics rather than this expired patent.

FAQs

What exact peptide is covered by claim 8 of US 5,674,710?

Claim 8 covers recombinant DNA encoding BNP-32 with the sequence SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.

Does US 5,674,710 cover synthetic chemical manufacture of nesiritide?

No. The claims require recombinant DNA, a recombinant expression system, a recombinant host cell, or a method using those cells. Purely chemical synthesis is outside the supplied claim language.

Can a company launch a nesiritide generic after October 7, 2014?

The expired patent does not prevent launch. FDA approval, product characterization, manufacturing controls, and applicable regulatory exclusivity remain separate requirements.

Is Natrecor protected by a biologic patent or a small-molecule patent?

US 5,674,710 is a biotechnology patent covering recombinant production of a peptide. Natrecor was approved through an NDA rather than the conventional BLA pathway used for many biological products.

Does the patent cover BNP diagnostic tests?

No. The claims do not cover measuring endogenous BNP, using BNP as a biomarker, antibody assays, diagnostic kits, or patient-risk stratification.

References

  1. United States Patent and Trademark Office. (1997). Recombinant DNA encoding human brain natriuretic peptide, U.S. Patent No. 5,674,710.
  2. U.S. Food and Drug Administration. (2001). Natrecor (nesiritide) prescribing information.
  3. U.S. Food and Drug Administration. (2024). Approved drug products with therapeutic equivalence evaluations: Orange Book.
  4. U.S. Food and Drug Administration. (2024). Drugs@FDA: FDA-approved drugs database.
  5. United States Code. (2024). 35 U.S.C. § 154: Contents and term of patent; provisional rights.

More… ↓

⤷  Start Trial


Drugs Protected by US Patent 5,674,710

Applicant Tradename Generic Name Dosage NDA Approval Date TE Type RLD RS Patent No. Patent Expiration Product Substance Delist Req. Patented / Exclusive Use Submissiondate
>Applicant >Tradename >Generic Name >Dosage >NDA >Approval Date >TE >Type >RLD >RS >Patent No. >Patent Expiration >Product >Substance >Delist Req. >Patented / Exclusive Use >Submissiondate

International Family Members for US Patent 5,674,710

Country Patent Number Estimated Expiration Supplementary Protection Certificate SPC Country SPC Expiration
Austria 126522 ⤷  Start Trial
Australia 3768189 ⤷  Start Trial
Canada 1339210 ⤷  Start Trial
Germany 68923878 ⤷  Start Trial
European Patent Office 0418308 ⤷  Start Trial
Ireland 68889 ⤷  Start Trial
Ireland 891792 ⤷  Start Trial
>Country >Patent Number >Estimated Expiration >Supplementary Protection Certificate >SPC Country >SPC Expiration

Make Better Decisions: Try a trial or see plans & pricing

Drugs may be covered by multiple patents or regulatory protections. All trademarks and applicant names are the property of their respective owners or licensors. Although great care is taken in the proper and correct provision of this service, thinkBiotech LLC does not accept any responsibility for possible consequences of errors or omissions in the provided data. The data presented herein is for information purposes only. There is no warranty that the data contained herein is error free. We do not provide individual investment advice. This service is not registered with any financial regulatory agency. The information we publish is educational only and based on our opinions plus our models. By using DrugPatentWatch you acknowledge that we do not provide personalized recommendations or advice. thinkBiotech performs no independent verification of facts as provided by public sources nor are attempts made to provide legal or investing advice. Any reliance on data provided herein is done solely at the discretion of the user. Users of this service are advised to seek professional advice and independent confirmation before considering acting on any of the provided information. thinkBiotech LLC reserves the right to amend, extend or withdraw any part or all of the offered service without notice.