Last Updated: July 4, 2026

Claims for Patent: 9,907,834


✉ Email this page to a colleague

« Back to Dashboard


Summary for Patent: 9,907,834
Title:Use of C-type natriuretic peptide variants to treat skeletal dysplasia
Abstract:The present disclosure provides for use of variants of C-type natriuretic peptide (CNP), and novel pharmaceutical compositions and formulations comprising CNP variant peptides for the treatment of skeletal dysplasias, one or more symptoms of skeletal dysplasias, such as long bone growth or growth velocity, and other disorders having a skeletal dysplasia and/or CNP-associated symptom or component.
Inventor(s):Sherry Bullens, Stuart Bunting, Tianwei Chou, Augustus O. Okhamafe, Christopher P. Price, Daniel J. Wendt, Clarence Yap
Assignee: Biomarin Pharmaceutical Inc
Application Number:US15/225,355
Patent Claims: 1. A formulation comprising: (a) a CNP variant peptide selected from the group consisting of [CNP-37(M32N); SEQ ID NO: 1] QEHPNARKYKGANKKGLSKGCFGLKLDRIGSNSGLGC; (Met-CNP-37; SEQ ID NO: 2) MQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC; (Pro-CNP-37; SEQ ID NO: 3) PQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC; [Gly-CNP 37(M32N); SEQ ID NO: 4] GQEHPNARKYKGANKKGLSKGCFGLKLDRIGSNSGLGC; (Pro-Gly-CNP-37; SEQ ID NO: 5) PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC; (Met-Gly-CNP-37; SEQ ID NO: 6) MGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC; and (Gly-CNP-37 or CNP-38: SEQ ID NO: 7) GQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC; and (b) citric acid monohydrate, sodium citrate dihydrate, trehalose dihydrate, D-mannitol, L-methionine and polysorbate 80.

2. The formulation of claim 1 that is lyophilized.

3. The formulation of claim 1 that is in liquid form or reconstituted from a lyophilized formulation.

4. The formulation of claim 1 that comprises at least about 2.0 mg/ml of said CNP peptide variant.

5. The formulation of claim 1, wherein said citric acid monohydrate is present at a concentration of from about 0.15 mg/ml to about 0.40 mg/ml, said sodium citrate dihydrate is present at a concentration of from about 0.5 mg/ml to about 1.5 mg/ml, said trehalose dihydrate is present at a concentration of from about 30 mg/ml to about 70 mg/ml, said D-mannitol is present at a concentration of from about 10 mg/ml to about 20 mg/ml, said L-methionine is present at a concentration of from about 0.5 mg/ml to about 1.5 mg/ml and said polysorbate 80 is present at a concentration of from about 0.01 mg/ml to about 0.1 mg/ml.

6. The formulation of claim 1, wherein said citric acid monohydrate is present at a concentration of about 0.28 mg/ml, said sodium citrate dihydrate is present at a concentration of about 1.08 mg/ml, said trehalose dihydrate is present at a concentration of about 58.01 mg/ml, said D-mannitol is present at a concentration of about 15 mg/ml, said L-methionine is present at a concentration of about 0.73 mg/ml and said polysorbate 80 is present at a concentration of about 0.05 mg/ml.

7. The formulation of claim 1 which is preservative-free.

8. The formulation of claim 1 having a pH of between about 5.0 and about 6.0.

Make Better Decisions: Try a trial or see plans & pricing

Drugs may be covered by multiple patents or regulatory protections. All trademarks and applicant names are the property of their respective owners or licensors. Although great care is taken in the proper and correct provision of this service, thinkBiotech LLC does not accept any responsibility for possible consequences of errors or omissions in the provided data. The data presented herein is for information purposes only. There is no warranty that the data contained herein is error free. We do not provide individual investment advice. This service is not registered with any financial regulatory agency. The information we publish is educational only and based on our opinions plus our models. By using DrugPatentWatch you acknowledge that we do not provide personalized recommendations or advice. thinkBiotech performs no independent verification of facts as provided by public sources nor are attempts made to provide legal or investing advice. Any reliance on data provided herein is done solely at the discretion of the user. Users of this service are advised to seek professional advice and independent confirmation before considering acting on any of the provided information. thinkBiotech LLC reserves the right to amend, extend or withdraw any part or all of the offered service without notice.