Last Updated: August 25, 2026

Claims for Patent: 8,198,242


✉ Email this page to a colleague

« Back to Dashboard


Summary for Patent: 8,198,242
Title:Variants of C-type natriuretic peptide
Abstract:The present disclosure provides variants of C-type natriuretic peptide (CNP), pharmaceutical compositions comprising CNP variants, and methods of making CNP variants. The CNP variants are useful as therapeutic agents for the treatment of diseases responsive to CNP, including but not limited to bone-related disorders, such as skeletal dysplasias (e.g., achondroplasia), and vascular smooth muscle disorders (e.g., restenosis and arteriosclerosis).
Inventor(s):Daniel J. Wendt, Shinong Long, Sianna CASTILLO, Christopher P. Price, Mika Aoyagi-Scharber, Michel C. Vellard, Augustus O. Okhamafe
Assignee: Biomarin Pharmaceutical Inc
Application Number:US12/784,117
Patent Litigation and PTAB cases: See patent lawsuits and PTAB cases for patent 8,198,242
Patent Claims: 1. A variant of C-type natriuretic peptide (CNP) selected from the group consisting of: (SEQ ID NO: 182) QEHPNARKYKGANKKGLSKGCFGLKLDRIGSNSGLGC [CNP37(M32N)]; (SEQ ID NO: 186) PQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Pro-CNP37); (SEQ ID NO: 192) MQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Met-CNP37); (SEQ ID NO: 181) GQEHPNARKYKGANKKGLSKGCFGLKLDRIGSNSGLGC [Gly-CNP37(M32N)]); (SEQ ID NO: 145) PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Pro-Gly-CNP37); and (SEQ ID NO: 191) MGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Met-Gly-CNP37).

2. A pharmaceutical composition comprising a CNP variant of claim 1, and a pharmaceutically acceptable excipient, carrier or diluent.

3. The composition of claim 2, which is a lyophilized formulation prepared from a formulation that comprises a citric acid/citrate buffer or an acetic acid/acetate buffer having a pH from about 4 to about 6.

4. A method of treating a bone-related disorder or skeletal dysplasia, comprising administering a CNP variant to a subject in need thereof, wherein the CNP variant is a CNP variant according to claim 1, and wherein the bone-related disorder or skeletal dysplasia is achondroplasia, and wherein the administering treats achondroplasia.

5. A method for recombinant production of a CNP variant, comprising culturing in a medium a host cell comprising a first polynucleotide encoding a CNP variant polypeptide linked to a second polynucleotide encoding a cleavable peptide or protein under conditions that result in expression of a fusion polypeptide encoded by the polynucleotides, wherein the fusion polypeptide comprises the CNP variant polypeptide directly linked to the cleavable peptide or protein or indirectly linked thereto via a linker wherein the CNP variant is selected from the group consisting of: (SEQ ID NO: 182) QEHPNARKYKGANKKGLSKGCFGLKLDRIGSNSGLGC [CNP37(M32N)]; (SEQ ID NO: 186) PQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Pro-CNP37); (SEQ ID NO: 192) MQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Met-CNP37); (SEQ ID NO: 181) GQEHPNARKYKGANKKGLSKGCFGLKLDRIGSNSGLGC [Gly-CNP37(M32N)]); (SEQ ID NO: 145) PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Pro-Gly-CNP37); and (SEQ ID NO: 191) MGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Met-Gly-CNP37).

6. The method of claim 5, wherein the cleavable peptide or protein is selected from the group consisting of histidine tags, human transcription factor TAF12, TAF12 fragments, TAF12 histone fold domain, mutants of TAF12 and fragments thereof, TAF12(C/A), TAF12(D/E), TAF12(4D/4E), TAF12(6D/6E), TAF12(10D/10E), TAF12(C/A & D/E), TAF12(C/A & 4D/4E), TAF12(C/A & 6D/6E), TAF12(C/A & 10D/10E), ketosteroid isomerase, maltose-binding protein, β-galactosidase, glutathione-S-transferase, thioredoxin, chitin-binding domain, BMP-2, BMP-2 mutants, BMP-2(C/A), and mutants and fragments thereof.

7. The method of claim 5, wherein the host cell is bacterial.

8. The method of claim 5, wherein the fusion polypeptide is expressed as a soluble protein or as an inclusion body.

9. The method of claim 5, further comprising isolating the expressed fusion polypeptide from the host cell or culture medium.

10. The method of claim 9, further comprising contacting the isolated fusion polypeptide with a cleaving agent selected from the group consisting of formic acid, cyanogen bromide (CNBr), hydroxylamine, protein self cleavage, Factor Xa, enterokinase, ProTEV, and SUMO protease.

11. The method of claim 5, which produces (SEQ ID NO: 145) PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Pro-Gly-CNP37)).

12. A CNP variant produced according to the method of claim 5, wherein the CNP variant is (SEQ ID NO: 145) PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Pro-Gly-CNP37).

13. The composition of claim 3, wherein (a) the lyophilized formulation is prepared from a formulation that further comprises an isotonicity-adjusting agent or a bulking agent, and/or (b) the lyophilized formulation is prepared from a formulation that further comprises an antioxidant.

14. The method of claim 4, wherein the CNP variant is PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Pro-Gly-CNP37) (SEQ ID NO: 145).

15. A method of increasing long bone growth, comprising administering a CNP variant to a subject in need thereof, wherein the CNP variant is a CNP variant according to claim 1, and wherein the administering increases long bone growth.

16. The method of claim 15, wherein the CNP variant is PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Pro-Gly-CNP37) (SEQ ID NO: 145).

17. A CNP variant useful for increasing long bone growth or treating achondroplasia in a subject, the CNP variant consisting of PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Pro-Gly-CNP37) (SEQ ID NO: 145).

Make Better Decisions: Try a trial or see plans & pricing

Drugs may be covered by multiple patents or regulatory protections. All trademarks and applicant names are the property of their respective owners or licensors. Although great care is taken in the proper and correct provision of this service, thinkBiotech LLC does not accept any responsibility for possible consequences of errors or omissions in the provided data. The data presented herein is for information purposes only. There is no warranty that the data contained herein is error free. We do not provide individual investment advice. This service is not registered with any financial regulatory agency. The information we publish is educational only and based on our opinions plus our models. By using DrugPatentWatch you acknowledge that we do not provide personalized recommendations or advice. thinkBiotech performs no independent verification of facts as provided by public sources nor are attempts made to provide legal or investing advice. Any reliance on data provided herein is done solely at the discretion of the user. Users of this service are advised to seek professional advice and independent confirmation before considering acting on any of the provided information. thinkBiotech LLC reserves the right to amend, extend or withdraw any part or all of the offered service without notice.