Last Updated: September 24, 2026

Claims for Patent: 12,324,787


✉ Email this page to a colleague

« Back to Dashboard


Summary for Patent: 12,324,787
Title:Kits for preparing and delivering purified corticotropin
Abstract:A kit and sterile preparation of purified corticotropin and methods relating thereto in which the preparation includes corticotropin extracted from a whole porcine pituitary gland including both anterior and posterior portions, and having proteins or peptides having a molecular weight higher than 4.6 kDa removed. Methods of manufacturing, testing, increasing stability, storage, and use of the purified corticotropin are also provided.
Inventor(s):Edward M. Desimone, III, Weijun Cheng, Zachary Holcomb
Assignee: ANI Pharmaceuticals Inc
Application Number:US18/905,498
Patent Claims: 1. A kit comprising a vial and a sterile preparation of purified corticotropin, wherein the sterile preparation comprises 80 USP units per mL of corticotropin, phenol, type A gelatin, water for injection (WFI), hydrochloric acid, and sodium hydroxide, wherein the vial is not terminally sterilized, and wherein the purified corticotropin comprises a polypeptide having an amino acid sequence of SYSMEHFRWGKPVGKKRRPVKVYPNGAEDELAEAFPLEF (SEQ ID NO: 1).

2. The kit of claim 1, further comprising instructions for using a first needle having a first gauge size with a first diameter to draw up the sterile preparation, and for injecting the sterile preparation using a second needle having a second gauge size with a second diameter.

3. The kit of claim 1, wherein the vial is a 5 mL multiple-dose vial.

4. The kit of claim 2, wherein the first diameter is wider than the second diameter.

5. The kit of claim 2, wherein the first gauge size is 20 G and the second gauge size is 23 G.

6. The kit of claim 1, wherein the sterile preparation comprises 0.5% w/w phenol, 15.0% w/w gelatin, and water for injection (WFI).

7. The kit of claim 1, wherein the sterile preparation comprises hydrochloric acid and sodium hydroxide.

8. The kit of claim 1, wherein the sterile preparation has a pH of 3.0-7.0.

9. The kit of claim 1, wherein the sterile preparation comprises purified corticotropin comprises an extract from whole porcine pituitary gland including both anterior and posterior portions of the whole porcine pituitary gland, 0.5% w/w phenol, 15% w/w gelatin type A, and water for injection (WFI).

10. The kit of claim 1, wherein the sterile preparation comprises about 15% w/w of the type A gelatin.

11. The kit of claim 1, wherein the sterile preparation comprises about 150 mg/ml of the type A gelatin.

12. The kit of claim 10, wherein the sterile preparation comprises about 0.1-1% w/w of the phenol.

13. The kit of claim 12, wherein the sterile preparation comprises about 0.5% w/w of the phenol.

14. The kit of claim 11, wherein sterile preparation comprises about 5 mg/ml of the phenol.

15. The kit of claim 1, wherein the kit further comprises instructions for use including washing hands and drying with a clean towel, removing the vial from a refrigerator, confirming that an expiration date on the vial has not passed, warming the gel in the vial from a solid gel to a liquid gel by rolling between hands for at least one minute, removing plastic cap from the top of the vial, wiping top of the vial stopper with a sterile alcohol wipe, using a sterile 20 G needle and syringe to draw up the warmed purified cortrophin gel from the vial, removing the 20 G needle, attaching a 23 G needle to the syringe, injecting the warmed purified cortrophin gel from the syringe into the subject.

16. The kit of claim 1, wherein the sterile preparation is preservative-free, antimicrobial-free, or preservative-free and antimicrobial-free.

17. The kit of claim 1, wherein the gelatin has a pH of 5.9 to 6.2.

18. The kit of claim 1, wherein the sterile preparation is free of acetic acid.

19. The kit of claim 1, wherein the gelatin is pyrogen-free.

20. The kit of claim 1, wherein the sterile preparation comprises acidified WFI having a pH of 2.8 to 3.2.

Make Better Decisions: Try a trial or see plans & pricing

Drugs may be covered by multiple patents or regulatory protections. All trademarks and applicant names are the property of their respective owners or licensors. Although great care is taken in the proper and correct provision of this service, thinkBiotech LLC does not accept any responsibility for possible consequences of errors or omissions in the provided data. The data presented herein is for information purposes only. There is no warranty that the data contained herein is error free. We do not provide individual investment advice. This service is not registered with any financial regulatory agency. The information we publish is educational only and based on our opinions plus our models. By using DrugPatentWatch you acknowledge that we do not provide personalized recommendations or advice. thinkBiotech performs no independent verification of facts as provided by public sources nor are attempts made to provide legal or investing advice. Any reliance on data provided herein is done solely at the discretion of the user. Users of this service are advised to seek professional advice and independent confirmation before considering acting on any of the provided information. thinkBiotech LLC reserves the right to amend, extend or withdraw any part or all of the offered service without notice.