Claims for Patent: 10,590,185
✉ Email this page to a colleague
Summary for Patent: 10,590,185
| Title: | Protease inhibitor: protease sensitive expression system and method improving the therapeutic activity and specificity of proteins and phage and phagemids delivered by bacteria |
| Abstract: | A genetically engineered live bacterium which is adapted to selectively replicate in and colonize a selected tissue type within the mammal, and concurrently produce within the selected tissue type at least one protease-sensitive cytotoxic molecule which is degradable by proteases within the selected tissue type, and at least one protease inhibitor peptide to inhibit the proteases within the selected tissue type from proteolytically degrading the protease sensitive cytotoxic molecule. The combination results in higher concentrations of the cytotoxic molecule local to the colonization, while permitting protease degradation of the cytotoxic molecule further away from the colonization. |
| Inventor(s): | Bermudes; David Gordon (Woodland Hills, CA) |
| Assignee: | |
| Application Number: | 15/600,267 |
| Patent Claims: | 1. A secreted chimeric protease inhibitor peptide, comprising: a protease inhibitor peptide sequence configured to selectively inhibit a protease; a therapeutic peptide
sequence having a protease cleavage site peptide sequence for the protease inhibited by the protease inhibitor peptide sequence; a targeting functionality peptide sequence; and a terminal cellular secretion signal peptide sequence, fused together, and
configured to selectively cause a cell to secrete the cellular secretion signal peptide sequence outside of the cell and inhibit degradation of the therapeutic peptide sequence by the protease inhibited by the protease inhibitor peptide sequence.
2. The secreted chimeric protease inhibitor peptide according to claim 1, wherein the protease inhibitor peptide sequence comprises a plurality of protease inhibitor peptide sequences. 3. The secreted chimeric protease inhibitor peptide according to claim 1, wherein the cellular secretion signal peptide sequence is an N-terminal secretion signal. 4. The secreted chimeric protease inhibitor peptide according to claim 1, wherein the cellular secretion signal peptide sequence is a C-terminal secretion signal, and the protease cleavage site peptide sequence is provided between the protease inhibitor peptide sequence and the cellular secretion signal peptide sequence. 5. The secreted chimeric protease inhibitor peptide according to claim 1, wherein the protease cleavage site peptide sequence is cleavable by the same protease that is inhibited by the protease inhibitor peptide sequence. 6. The secreted chimeric protease inhibitor peptide according to claim 1, wherein the protease inhibitor peptide sequence is configured to inhibit a protease selected from the group consisting of tissue plasminogen activator, activated protein C, factor Xa, granzyme A, granzyme B, granzyme M, cathepsin, thrombin, plasmin, urokinase, matrix metalloproteases, prostate specific antigen, and kallikrein 2. 7. The secreted chimeric protease inhibitor peptide according to claim 1, wherein the protease inhibitor peptide sequence is selected from the group consisting of: Inhibitors of kallikrein 2: TABLE-US-00016 SEQ ID NO: 9 SRFKVWWAAG, SEQ ID NO: 10 AARRPFPAPS, SEQ ID NO: 11 PARRPFPVTA, Tissue protease inhibitor SEQ ID NO: 12 DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILI QKSGPC (serine protease inhibitor, Kazal type 1, mature), Furin inhibitors: SEQ ID NO: 1 PAAATVTKKVAKSPKKAKAAKPKKAAKSAAKAVKPK, SEQ ID NO: 2 TKKVAKRPRAKRAA, SEQ ID NO: 3 TKKVAKRPRAKRDL, SEQ ID NO: 4 GKRPRAKRA, SEQ ID NO: 5 CKRPRAKRDL, SEQ ID NO: 6 CVAKRPRAKRDL, SEQ ID NO: 7 CKKVAKRPRAKRDL, and SEQ ID NO: 8 RRRRRR L6R (hexa-L-arginine). 8. The secreted chimeric protease inhibitor peptide according to claim 1, wherein the cellular secretion signal peptide sequence comprises an N-terminal signal sequence from a cytolethal distending toxin gene. 9. The secreted chimeric protease inhibitor peptide according to claim 1, wherein the cellular secretion signal peptide sequence comprises a C-terminal hemolysin C (hlyC) signal sequence. 10. The secreted chimeric protease inhibitor peptide according to claim 1, wherein the cellular secretion signal peptide sequence comprises a C-terminal hemolysin C (hlyC) signal sequence, separated from the protease inhibitor peptide sequence by protease cleavage site peptide sequence. 11. The secreted chimeric protease inhibitor peptide according to claim 1, wherein the protease inhibitor peptide sequence comprises at least one furin inhibitor. 12. The secreted chimeric protease inhibitor peptide according to claim 1, produced in a bacterium from a synthetic gene comprising a promoter, operably linked to a ribosomal binding site. 13. The secreted chimeric protease inhibitor peptide according to claim 1, wherein the therapeutic peptide sequence comprises at least one protease-sensitive cytotoxic molecule having the protease cleavage site peptide sequence inhibited by the protease inhibitor peptide sequence. 14. The secreted chimeric protease inhibitor peptide according to claim 13, wherein the at least one protease-sensitive cytotoxic molecule is a cytolethal distending toxin (cldt). 15. The secreted chimeric protease inhibitor peptide according to claim 1, wherein the targeting functionality peptide sequence comprises a tumor tissue targeting peptide sequence. 16. A secreted chimeric protease inhibitor peptide, comprising a fusion of: a protease inhibitor peptide sequence configured to selectively inhibit a protease; a therapeutic peptide sequence comprising a protease cleavage site peptide sequence inhibited by the protease inhibitor peptide sequence; a targeting functionality peptide sequence; and a terminal cellular secretion signal peptide sequence, configured to selectively cause a cell to secrete the chimeric protease inhibitor peptide outside of the cell and inhibit cleavage of the protease cleavage site peptide sequence by the protease inhibited by the protease inhibitor peptide sequence. 17. The secreted chimeric protease inhibitor peptide according to claim 16, wherein the therapeutic peptide sequence comprises a toxic functionality peptide sequence. 18. The secreted chimeric protease inhibitor peptide according to claim 17, wherein the toxic functionality peptide sequence comprises the protease cleavage site peptide sequence, and the protease inhibitor peptide sequence is configured to selectively inhibit a protease which cleaves at least the protease cleavage site peptide sequence. 19. A secreted chimeric protease inhibitor peptide having a plurality of fused portions, comprising: a terminal cellular secretion signal peptide sequence first fused portion, configured to selectively cause a cell to secrete the chimeric protease inhibitor peptide comprising the terminal cellular secretion signal peptide sequence outside of the cell; a protease inhibitor peptide sequence second fused portion configured to selectively inhibit a protease; a toxic functionality peptide sequence third fused portion comprising a protease cleavage site peptide sequence portion configured to be cleaved by the protease; and a targeting functionality peptide sequence fourth fused portion. 20. The secreted chimeric protease inhibitor peptide according to claim 19, wherein the protease inhibitor peptide sequence second fused portion is configured to inhibit the protease, thereby protecting the toxic functionality peptide sequence portion from cleavage by the protease. |
Details for Patent 10,590,185
| Applicant | Tradename | Biologic Ingredient | Dosage Form | BLA | Approval Date | Patent No. | Expiredate |
|---|---|---|---|---|---|---|---|
| Microbix Biosystems Inc. | KINLYTIC | urokinase | For Injection | 021846 | 16-Jan-78 | ⤷ Start Trial | 2037-05-19 |
| >Applicant | >Tradename | >Biologic Ingredient | >Dosage Form | >BLA | >Approval Date | >Patent No. | >Expiredate |
Make Better Decisions: Try a trial or see plans & pricing
Drugs may be covered by multiple patents or regulatory protections. All trademarks and applicant names are the property of their respective owners or licensors. Although great care is taken in the proper and correct provision of this service, thinkBiotech LLC does not accept any responsibility for possible consequences of errors or omissions in the provided data. The data presented herein is for information purposes only. There is no warranty that the data contained herein is error free. We do not provide individual investment advice. This service is not registered with any financial regulatory agency. The information we publish is educational only and based on our opinions plus our models. By using DrugPatentWatch you acknowledge that we do not provide personalized recommendations or advice. thinkBiotech performs no independent verification of facts as provided by public sources nor are attempts made to provide legal or investing advice. Any reliance on data provided herein is done solely at the discretion of the user. Users of this service are advised to seek professional advice and independent confirmation before considering acting on any of the provided information. thinkBiotech LLC reserves the right to amend, extend or withdraw any part or all of the offered service without notice.
