.

Pharmaceutical Business Intelligence

  • Anticipate P&T budget requirements
  • Evaluate market entry opportunities
  • Find generic sources and suppliers
  • Predict branded drug patent expiration

► Plans and Pricing

Upgrade to enjoy subscriber-only features like email alerts and data export. See the Plans and Pricing

DrugPatentWatch Database Preview

Details for Patent: 6,060,065

« Back to Dashboard

Details for Patent: 6,060,065

Title: Compositions for inhibition of membrane fusion-associated events, including influenza virus transmission
Abstract:The present invention relates to viral peptides referred to as "DP107- and DP178-like" peptides. Specifically, the invention relates to isolated influenza A DP107- and DP178-like peptides which are identified by sequence search motif algorithms. The peptides of the invention exhibit antiviral activity believed to result from inhibition of viral induced fusogenic events.
Inventor(s): Barney; Shawn O'Lin (Cary, NC), Lambert; Dennis Michael (Cary, NC), Petteway; Stephen Robert (Cary, NC)
Assignee: Trimeris, Inc. (Durham, NC) Duke University (Durham, NC)
Filing Date:Jun 07, 1995
Application Number:08/475,668
Claims:1. An isolated peptide region of an influenza A virus protein, said region comprising an amino acid sequence identified by an ALLMOT15, 107.times.178.times.4, or PLZIP sequence search motif.

2. An isolated peptide of the formula

X-QAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTI-Z (SEQ ID NO. 210); or

X-AADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHT IDLT-Z (SEQ ID NO. 211),

in which:

X comprises an amino group, an acetyl group, a 9-fluoroenylmethoxy-carbonyl group, a hydrophobic group, or a macromolecular carrier group; and

Z comprises a carboxyl group, an amido group, a hydrophobic group, or a macromolecular carrier group.

3. The peptide of claim 2 of the formula:

X-QAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTI-Z (SEQ ID NO. 210).

4. The peptide of claim 2 of the formula:

X-AADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHT IDLT-Z (SEQ ID NO. 211).

5. The peptide of claim 3 or 4, wherein X is an acetyl group and Z is an amido group.
« Back to Dashboard

For more information try a trial or see the database preview and plans and pricing

Drugs may be covered by multiple patents or regulatory protections. All trademarks and applicant names are the property of their respective owners or licensors. Although great care is taken in the proper and correct provision of this service, thinkBiotech LLC does not accept any responsibility for possible consequences of errors or omissions in the provided data. The data presented herein is for information purposes only. There is no warranty that the data contained herein is error free. thinkBiotech performs no independent verifification of facts as provided by public sources nor are attempts made to provide legal or investing advice. Any reliance on data provided herein is done solely at the discretion of the user. Users of this service are advised to seek professional advice and independent confirmation before considering acting on any of the provided information. thinkBiotech LLC reserves the right to amend, extend or withdraw any part or all of the offered service without notice.

`abc