Claims for Patent: 9,512,221

Summary for Patent: 9,512,221

Title:	Anti-TLR4 antibodies and methods of use thereof
Abstract:	This invention relates generally to antibodies that specifically bind Toll-like Receptor 4 (TLR-4), and to methods of using the anti-TLR4 antibodies as therapeutics and to methods of using the anti-TLR4 antibodies in methods of preventing transplant rejection and/or prolonging survival of transplanted biological material.
Inventor(s):	Kosco-Vilbois; Marie (Minzier, FR), De Graaf; Katrien L. (Nyon, CH), Berney; Thierry (Arenthon, FR), Giovannoni; Santa (Annemasse, FR), Bosco; Domenic (Geneva, CH)
Assignee:	NOVIMMUNE S.A. (Geneva, CH)
Application Number:	14/278,583
Patent Claims:	1. A method of inhibiting rejection of or prolonging survival of transplanted biological material in a subject, the method comprising: (i) contacting the biological material to be transplanted with an antibody or antigen binding fragment thereof that specifically binds a human Toll-like receptor 4 (TLR4) polypeptide to produce a transplantable composition, and (ii) implanting the transplantable composition at a desired location in the subject, wherein the antibody or antigen binding fragment thereof is administered in an amount sufficient to prolong survival of the transplanted biological material in the subject, and wherein the antibody or antigen binding fragment thereof comprises the heavy chain amino acid sequence MGWSWIFLFLLSGTAGVHCQVQLQESGPGLVKPSDTLSLTCAVSG YSITGGYSWHWIRQPPGKGLEWMGYIHYSGYTDFNPSLKTRITISRDTSKNQFSLKLSSV TAVDTAVYYCARKDPSDAFPYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGC LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNH KPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVV DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKC KVSSKAFPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEW ESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQK SLSLSPGK (SEQ ID NO: 9) and the light chain amino acid sequence MEWSWVFLFFLSVTT GVHSEIVLTQSPDFQSVTPKEKVTITCRASQSISDHLHWYQQKPDQSPKLLIKYASHAISG VPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQGHSFPLTFGGGTKVEIKRTVAAPSVFIF PPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSS TLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 10), thereby inhibiting rejection of or prolonging survival of transplanted biological material in the subject. 2. The method of claim 1, wherein the subject is a human. 3. The method of claim 1, wherein the biological material to be transplanted is selected from the group consisting of one or more cells or cell types, one or more tissues or tissue types, an organ or portion thereof, allogeneic biological material, islet cells, allogeneic islet cells, biological material that is or is derived from kidney, biological material that is or is derived from pancreas, biological material that is or is derived from liver, and biological material that is or is derived from intestine. 4. The method of claim 1, wherein the antibody or antigen binding fragment thereof that specifically binds TLR4 is administered in combination with one or more additional agents. 5. The method of claim 4, wherein the one or more additional agents is one or more immunosuppressive agents. 6. The method of claim 4, wherein the one or more additional agents is selected from methotrexate, cyclosporin A, tacrolimus, sirolimus, everolimus, a corticosteroid, anti-thymocyte globulin, Infliximab, Etanercept and Adalimumab.

Details for Patent 9,512,221

Applicant	Tradename	Biologic Ingredient	Dosage Form	BLA	Approval Date	Patent No.	Expiredate
Janssen Biotech, Inc.	REMICADE	infliximab	For Injection	103772	08/24/1998		2031-01-10
Immunex Corporation	ENBREL	etanercept	For Injection	103795	11/02/1998		2031-01-10
Immunex Corporation	ENBREL	etanercept	For Injection	103795	05/27/1999		2031-01-10