Claims for Patent: 8,541,568
✉ Email this page to a colleague
Summary for Patent: 8,541,568
Title: | Compositions and methods using siRNA molecules for treatment of gliomas |
Abstract: | The present invention provides small interfering RNA (siRNA) molecules, compositions containing the molecules, and methods of using the compositions to treat gliomas. |
Inventor(s): | Yan; Hai (Durham, NC), Lu; Patrick Y. (Rockville, MD), Bigner; Darell D. (Durham, NC) |
Assignee: | |
Application Number: | 12/994,738 |
Patent Claims: | 1. A composition comprising at least three isolated siRNA molecules, wherein at least one isolated siRNA molecule (sense: 5'-CUGUAGACACACCCACCCACAUACA-3' (SEQ ID NO: 10),
antisense: 5'-UGUAUGUGGGUGGGUGUGUCUACAG-3') (SEQ ID NO: 11) binds to an mRNA molecule that encodes a human VEGF protein and binds to an mRNA molecule that encodes a mouse VEGF protein, at least one isolated siRNA molecule (sense:
5'-CCAUCGAUGUCUACAUGAUCAUGGU-3' (SEQ ID NO: 14), antisense: 5'-ACCAUGAUCAUGUAGACAUCGAUGG-3') (SEQ ID NO: 15) binds to an mRNA molecule that encodes a human EGFR protein and binds to an mRNA molecule that encodes a mouse EGFR protein, and at least one
isolated siRNA molecule (sense: 5'-GCUGAAGGUUGUGAAAUUCGGAGAA-3' (SEQ ID NO: 18), antisense: 5'-UUCUCCGAAUUUCACAACCUUCAGC-3') (SEQ ID NO: 19) binds to an mRNA molecule that encodes a human MGMT protein and binds to an mRNA molecule that encodes a mouse
MGMT protein.
2. The composition of claim 1, further comprising a pharmaceutically acceptable carrier. 3. The composition of claim 2, wherein said carrier comprises at least one of the following: a glucose solution, a polycationic binding agent, a cationic lipid, a cationic micelle, a cationic polypeptide, a hydrophilic polymer grafted polymer, a non-natural cationic polymer, a cationic polyacetal, a hydrophilic polymer grafted polyacetal, a ligand functionalized cationic polymer, a ligand functionalized-hydrophilic polymer grafted polymer, and a ligand functionalized liposome. 4. The composition of claim 3, wherein said ligand comprises one or more of an RGD peptide, an RVG peptide, or a FROP peptide. 5. The composition of claim 3, wherein said polymers comprise a biodegradable histidine-lysine polymer, a biodegradable polyester, a polyamidoamine (PAMAM) dendrimer, a cationic lipid, optionally DOTAP, and a PEGylated PEI. 6. The composition of claim 2, wherein said carrier comprises a histidine-lysine copolymer that forms a nanoparticle with the siRNA molecules. 7. The composition of claim 1, further comprising a therapeutic agent that impedes or blocks tumorigenesis, angiogenesis, or cell proliferation in the brain or spinal cord of a mammal. 8. The composition of claim 7, wherein said therapeutic agent is selected from the group consisting of bevacizumab, sunitinib, sorafenib, temsirolimus, and temozolomide. 9. A nanoparticle comprising the siRNA molecules of claim 1, a pharmaceutically acceptable carrier, and a targeting ligand. 10. The nanoparticle of claim 9, wherein said pharmaceutically accepable carrier is a histidine-lysine copolymer. 11. The nanoparticle of claim 9, wherein said targeting ligand is selected from the group consisting of EGF receptor ligands, IL13 ligand, hepatocyte growth factor ligand, single chain monoclonal antibodies, RGD peptide ligands, and RVG peptide ligands. 12. The composition of claim 4 wherein said RGD peptide is H-ACRGDMFGCA-OH, said RVG peptide is H-YTIWMPENPRPGTPCDIFTNSRGKRASNG-OH, and said FROP peptide is H-EDYELMDLLAYL-OH. 13. The composition of claim 5 wherein said biodegradable polyester comprises poly(lactic acid) (PLA), poly(glycolic acid) (PGA), or poly(lactic-co-glycolic acid) (PLGA). 14. The nanoparticle of claim 9 wherein said targeting ligand is an RGD peptide ligand or an RVG peptide ligand. 15. The nanoparticle of claim 14 wherein said RGD peptide ligand is a `cyclic` 10mer RGD peptide with the sequence H-ACRGDMFGCA-OH, and -(D)CR(D)WKTCT-(ol). 16. The nanoparticle of claim 14 wherein said RVG peptide ligand is YTIWMPENPRPGTPCDIFTNSRGKRASNG or YTIWMPENPRPGTPCDIFTNS-RGKRASNGGGGRRRRRRRRR. |
Details for Patent 8,541,568
Applicant | Tradename | Biologic Ingredient | Dosage Form | BLA | Approval Date | Patent No. | Expiredate |
---|---|---|---|---|---|---|---|
Genentech, Inc. | AVASTIN | bevacizumab | Injection | 125085 | 02/26/2004 | ⤷ Try a Trial | 2028-05-24 |
>Applicant | >Tradename | >Biologic Ingredient | >Dosage Form | >BLA | >Approval Date | >Patent No. | >Expiredate |
Make Better Decisions: Try a trial or see plans & pricing
Drugs may be covered by multiple patents or regulatory protections. All trademarks and applicant names are the property of their respective owners or licensors. Although great care is taken in the proper and correct provision of this service, thinkBiotech LLC does not accept any responsibility for possible consequences of errors or omissions in the provided data. The data presented herein is for information purposes only. There is no warranty that the data contained herein is error free. thinkBiotech performs no independent verification of facts as provided by public sources nor are attempts made to provide legal or investing advice. Any reliance on data provided herein is done solely at the discretion of the user. Users of this service are advised to seek professional advice and independent confirmation before considering acting on any of the provided information. thinkBiotech LLC reserves the right to amend, extend or withdraw any part or all of the offered service without notice.