Claims for Patent: 7,723,485
✉ Email this page to a colleague
Summary for Patent: 7,723,485
Title: | Cysteine engineered anti-MUC16 antibodies and antibody drug conjugates |
Abstract: | Cysteine engineered anti-MUC16 antibodies are engineered by replacing one or more amino acids of a parent anti-MUC16 antibody with non cross-linked, reactive cysteine amino acids. Methods of design, preparation, screening, and selection of the cysteine engineered anti-MUC16 antibodies are provided. Cysteine engineered anti-MUC16 antibodies (Ab) are conjugated with one or more drug moieties (D) through a linker (L) to form cysteine engineered anti-MUC16 antibody-drug conjugates having Formula I: Ab-(L-D).sub.p I where p is 1 to 4. Diagnostic and therapeutic uses for cysteine engineered antibody drug compounds and compositions are disclosed. |
Inventor(s): | Junutula; Jagath R. (Fremont, CA), Mallet; William (Redwood City, CA) |
Assignee: | Genentech, Inc. (South San Francisco, CA) |
Application Number: | 12/116,457 |
Patent Claims: | 1. An isolated cysteine engineered anti-MUC16 antibody which binds to a MUC16 polypeptide comprising the heavy chain sequence of SEQ ID NO:1.
2. The cysteine engineered anti-MUC16 antibody of claim 1 prepared by a process comprising replacing the residue at position 117 in the heavy chain of a parent anti-MUC16 antibody by cysteine. 3. The cysteine engineered anti-MUC16 antibody of claim 1 further comprising the light chain sequence: TABLE-US-00009 SEQ ID NO:2 DIQMTQSPSSLSASVGDRVTITCKASDLIHNWLAWYQQKPGKAFKLLIYG ATSLETGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYWTTPFTFGQ GTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKV DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG LSSFVTKSFNRGEC. 4. The cysteine engineered anti-MUC16 antibody of claim 2 wherein the parent anti-MUC16 antibody is selected from a monoclonal antibody, a bispecific antibody, a chimeric antibody, a human antibody, and a humanized antibody. 5. The cysteine engineered anti-MUC16 antibody of claim 1 which is a Fab fragment. 6. The cysteine engineered anti-MUC16 antibody of claim 1 which is produced in bacteria. 7. The cysteine engineered anti-MUC16 antibody of claim 1 which is produced in CHO cells. 8. A method of determining the presence of a MUC16 protein in a sample suspected of containing said protein, said method comprising the steps of: exposing said sample to the cysteine engineered anti-MUC16 antibody having the heavy chain sequence of SEQ ID NO:1, and; determining binding of said antibody to said MUC16 protein in said sample, wherein binding of the antibody to said protein is indicative of the presence of said protein in said sample. 9. The method of claim 8 wherein said sample is an ovarian, breast, lung, or pancreatic cancer cell. 10. The method of claim 8 wherein the antibody is covalently attached to a label selected from a fluorescent dye, a radioisotope, biotin, or a metal-complexing ligand. 11. The cysteine engineered anti-MUC16 antibody of claim 1 wherein the antibody is covalently attached to an auristatin drug moiety whereby an antibody-drug conjugate is formed. 12. An antibody-drug conjugate comprising a cysteine engineered anti-MUC16 antibody (Ab) which binds to a MUC16 polypeptide and comprising the heavy chain sequence of SEQ ID NO: 1, and an auristatin drug moiety (D) wherein the cysteine engineered anti-MUC16 antibody is attached through a free cysteine amino acid by a linker moiety (L) to D; the compound having Formula I: Ab-(L-D).sub.p I where p is 1, 2, 3, or 4. 13. The antibody-drug conjugate compound of claim 12 wherein p is 2. 14. The antibody-drug conjugate compound of claim 12 wherein L has the formula: -A.sub.a-W.sub.w--Y.sub.y-- where: A is a Stretcher unit covalently attached to a cysteine thiol of the cysteine engineered antibody (Ab); a is 0 or 1; each W is independently an Amino Acid unit; w is an integer ranging from 0 to 12; Y is a Spacer unit covalently attached to the drug moiety; and y is 0, 1 or 2. 15. The antibody-drug conjugate compound of claim 14 having the formula: ##STR00020## where PAB is para-aminobenzylcarbamoyl, and R.sup.17 is a divalent radical selected from (CH.sub.2).sub.r, C.sub.3-C.sub.8 carbocyclyl, O--(CH.sub.2).sub.r, arylene, (CH.sub.2).sub.r-arylene, -arylene-(CH.sub.2).sub.r--, (CH.sub.2).sub.r--(C.sub.3-C.sub.8 carbocyclyl), (C.sub.3-C.sub.8 carbocyclyl)-(CH.sub.2).sub.r, C.sub.3-C.sub.8 heterocyclyl, (CH.sub.2).sub.r--(C.sub.3-C.sub.8 heterocyclyl), --(C.sub.3-C.sub.8 heterocyclyl)-(CH.sub.2).sub.r--, --(CH.sub.2).sub.rC(O)NR.sup.b(CH.sub.2).sub.r--, --(CH.sub.2CH.sub.2O).sub.r--, --(CH.sub.2CH.sub.2O).sub.r--CH.sub.2--, --(CH.sub.2).sub.rC(O)NR.sup.b(CH.sub.2CH.sub.2O).sub.r--, --(CH.sub.2).sub.rC(O)NR.sup.b(CH.sub.2CH.sub.2O).sub.r--CH.sub.2--, --(CH.sub.2CH.sub.2O).sub.rC(O)NR.sup.b(CH.sub.2CH.sub.2O).sub.r--, --(CH.sub.2CH.sub.2O).sub.rC(O)NR.sup.b(CH.sub.2CH.sub.2O).sub.r--CH.sub.- 2--, and --(CH.sub.2CH.sub.2O).sub.rC(O)NR.sup.b(CH.sub.2).sub.r--; where R.sup.b is H, C.sub.1-C.sub.8 alkyl, phenyl, or benzyl; and r is independently an integer ranging from 1 to 10. 16. The antibody-drug conjugate compound of claim 14 wherein W.sub.w is valine-citrulline. 17. The antibody-drug conjugate compound of claim 14 wherein R.sup.17 is (CH.sub.2).sub.5 or (CH.sub.2).sub.2. 18. The antibody-drug conjugate compound of claim 14 having the formula: ##STR00021## 19. The antibody-drug conjugate compound of claim 18 wherein R.sup.17 is (CH.sub.2).sub.5 or (CH.sub.2).sub.2. 20. The antibody-drug conjugate compound of claim 14 having the formula: ##STR00022## 21. The antibody drug conjugate of claim 12 wherein L is MC-val-cit-PAB or MC. 22. The antibody-drug conjugate compound of claim 12 wherein L is a linker formed by linker reagents SMCC, BM(PEO).sub.2 or BM(PEO).sub.3. 23. The antibody-drug conjugate compound of claim 12 wherein D is MMAE, having the structure: ##STR00023## where the wavy line indicates the attachment site to the linker L. 24. The antibody-drug conjugate compound of claim 12 wherein D is MMAF, having the structure: ##STR00024## where the wavy line indicates the attachment site to the linker L. 25. The antibody-drug conjugate compound of claim 12 wherein the cysteine engineered anti-MUC16 antibody is selected from a monoclonal antibody, a bispecific antibody, a chimeric antibody, a human antibody, and a humanized antibody. 26. The antibody-drug conjugate compound of claim 12 wherein the cysteine engineered anti-MUC16 antibody is a Fab fragment. 27. An antibody-drug conjugate compound selected from the structures: ##STR00025## wherein Val is valine; Cit is citrulline; p is 1, 2, 3, or 4; and Ab is a cysteine engineered anti-MUC16 antibody which binds to a MUC16 polypeptide and comprising the heavy chain sequence of SEQ ID NO: 1. 28. The antibody drug conjugate of claim 27 wherein Ab further comprises SEQ ID NO: 2. 29. A mixture of antibody-drug conjugate compounds comprising a cysteine engineered anti-MUC16 antibody (Ab) which binds to a MUC16 polypeptide and comprising the heavy chain sequence of SEQ ID NO: 1, and an auristatin drug moiety (D) wherein the cysteine engineered anti-MUC16 antibody is attached through a free cysteine amino acid by a linker moiety (L) to D; the compound having Formula I: Ab-(L-D).sub.p I where p is 1, 2, 3, or 4, and the average drug loading is from 1 to 2. 30. A pharmaceutical formulation comprising an antibody-drug conjugate comprising a cysteine engineered anti-MUC16 antibody which binds to a MUC16 polypeptide and comprising the heavy chain sequence SEQ ID NO: 1 and where the cysteine engineered anti-MUC16 antibody is covalently attached through a free cysteine amino acid to an auristatin drug moiety, and a pharmaceutically acceptable diluent, carrier or excipient. 31. The pharmaceutical formulation of claim 30 further comprising a therapeutically effective amount of a chemotherapeutic agent selected from letrozole, oxaliplatin, docetaxel, 5-FU, lapatinib, capecitabine, leucovorin, erlotinib, pertuzumab, bevacizumab, and gemcitabine. 32. A method of treating cancer comprising administering to a patient a pharmaceutical formulation comprising an antibody-drug conjugate comprising a cysteine engineered anti-MUC16 antibody which binds to a MUC16 polypeptide and having the heavy chain sequence of SEQ ID NO: 1 and where the cysteine engineered anti-MUC16 antibody is covalently attached through a free cysteine amino acid to an auristatin drug moiety, and a pharmaceutically acceptable diluent, carrier or excipient; and wherein the cancer is selected from the group consisting of ovarian cancer, prostate cancer, cancer of the urinary tract, pancreatic cancer, lung cancer, breast cancer, and colon cancer. 33. The method of claim 32 wherein the patient is administered a chemotherapeutic agent in combination with the antibody-drug conjugate compound, where the chemotherapeutic agent is selected from letrozole, cisplatin, carboplatin, taxol, paclitaxel, oxaliplatin, docetaxel, 5-FU, leucovorin, erlotinib, pertuzumab, bevacizumab, lapatinib, and gemcitabine. 34. An article of manufacture comprising a pharmaceutical formulation comprising an antibody-drug conjugate comprising a cysteine engineered anti-MUC16 antibody which binds to a MUC16 polypeptide and having the heavy chain sequence of SEQ ID NO: 1 and where the cysteine engineered anti-MUC16 antibody is covalently attached through a free cysteine amino acid to an auristatin drug moiety, and a pharmaceutically acceptable diluent, carrier or excipient; a container; and a package insert or label indicating that the compound can be used to treat ovarian cancer, prostate cancer, cancer of the urinary tract, pancreatic cancer, lung cancer, breast cancer, or colon cancer characterized by the overexpression of a MUC16 polypeptide. 35. A method for making an antibody drug conjugate compound comprising a cysteine engineered anti-MUC16 antibody (Ab) which binds to a MUC16 polypeptide and having the heavy chain sequence of SEQ ID NO: 1, and an auristatin drug moiety (D) wherein the cysteine engineered antibody is attached through an engineered cysteine amino acid by a linker moiety (L) to D; the compound having Formula I: Ab-(L-D).sub.p I where p is 1, 2, 3, or 4; the method comprising the steps of: (a) reacting an engineered cysteine group of the cysteine engineered antibody with a linker reagent to form antibody-linker intermediate Ab-L; and (b) reacting Ab-L with an activated drug moiety D; whereby the antibody-drug conjugate compound is formed; or comprising the steps of: (c) reacting a nucleophilic group of a drug moiety with a linker reagent to form drug-linker intermediate D-L; and (d) reacting D-L with an engineered cysteine group of the cysteine engineered antibody; whereby the antibody-drug conjugate compound is formed. 36. The method of claim 35 further comprising the step of expressing the cysteine engineered antibody in chinese hamster ovary (CHO) cells. 37. The method of claim 36 further comprising the step of treating the expressed cysteine engineered antibody with a reducing agent. 38. The method of claim 37 wherein the reducing agent is selected from TCEP and DTT. 39. The method of claim 38 further comprising the step of treating the expressed cysteine engineered antibody with an oxidizing agent, after treating with the reducing agent. 40. The method of claim 39 wherein the oxidizing agent is selected from copper sulfate, dehydroascorbic acid, and air. |
Details for Patent 7,723,485
Applicant | Tradename | Biologic Ingredient | Dosage Form | BLA | Approval Date | Patent No. | Expiredate |
---|---|---|---|---|---|---|---|
Genentech, Inc. | AVASTIN | bevacizumab | Injection | 125085 | 02/26/2004 | ⤷ Try a Trial | 2039-02-26 |
Genentech, Inc. | PERJETA | pertuzumab | Injection | 125409 | 06/08/2012 | ⤷ Try a Trial | 2039-02-26 |
>Applicant | >Tradename | >Biologic Ingredient | >Dosage Form | >BLA | >Approval Date | >Patent No. | >Expiredate |
Make Better Decisions: Try a trial or see plans & pricing
Drugs may be covered by multiple patents or regulatory protections. All trademarks and applicant names are the property of their respective owners or licensors. Although great care is taken in the proper and correct provision of this service, thinkBiotech LLC does not accept any responsibility for possible consequences of errors or omissions in the provided data. The data presented herein is for information purposes only. There is no warranty that the data contained herein is error free. thinkBiotech performs no independent verification of facts as provided by public sources nor are attempts made to provide legal or investing advice. Any reliance on data provided herein is done solely at the discretion of the user. Users of this service are advised to seek professional advice and independent confirmation before considering acting on any of the provided information. thinkBiotech LLC reserves the right to amend, extend or withdraw any part or all of the offered service without notice.