Claims for Patent: 10,421,809
✉ Email this page to a colleague
Summary for Patent: 10,421,809
Title: | Anti-TLR4 antibodies and uses thereof |
Abstract: | This invention relates generally to antibodies that specifically bind Toll-like Receptor 4 (TLR-4), and to methods of using the anti-TLR4 antibodies as therapeutics and to methods of using the anti-TLR4 antibodies in methods of preventing transplant rejection and/or prolonging survival of transplanted biological material. |
Inventor(s): | Kosco-Vilbois; Marie (Minzier, FR), De Graaf; Katrien (Nyon, CH), Berney; Thierry (Arenthon, FR), Santa Giovannoni; Laurianne (Annemasse, FR), Bosco; Domenic (Geneva, CH) |
Assignee: | NovImmune SA (Geneva, CH) |
Application Number: | 15/370,466 |
Patent Claims: | 1. A method of treating a subject who has received or will receive a transplant of biological material, the method comprising administering to the subject one or more doses
of an antibody or antigen binding fragment thereof that specifically binds a Toll-like receptor 4 (TLR4) polypeptide, wherein the antibody or antigen binding fragment thereof is administered in an amount sufficient to prevent transplant rejection or
prolong survival of the transplanted biological material in the subject and wherein the antibody or antigen binding fragment thereof comprises the heavy chain amino acid sequence MGWSWIFLFLLSGTAGVHCQVQLQESGPGLVKPSDTLSLTCAVSGYSITGGYSWHWIRQPPGKGLEWMGYIHY-
SGYTDFNPSLKTRITISRDTSKNQFSLKLSSVTAVDTAVYYCARKDPSDAFPYWGQGTLVTVSSASTKGPSVFP- LAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICN- VNHKPSNT KVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVK-
FNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSSKAFPAPIEKTISKAKGQPREPQV- YTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV- FSCSVMHEALHNHYTQ KSLSLSPGK (SEQ ID NO: 9) and the light chain amino acid sequence
MEWSWVFLFFLSVTTGVHSEIVLTQSPDFQSVTPKEKVTITCRASQSISDHLHWYQQKPDQSPK- LLIKYASHAISGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQGHSFPLTFGGGTKVEIKRTVAAPSVFIFP- PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYA- CEVTHQGLSSPVTKSFN RGEC (SEQ ID NO:
10).
2. The method of claim 1, wherein the subject is a human. 3. The method of claim 1, wherein the TLR4 polypeptide is a human TLR4 polypeptide. 4. The method of claim 1, wherein the biological material to be transplanted is selected from the group consisting of one or more cells or cell types, one or more tissues or tissue types, an organ or portion thereof, allogeneic biological material, islet cells, allogeneic islet cells, biological material that is or is derived from kidney, biological material that is or is derived from pancreas, biological material that is or is derived from liver, and biological material that is or is derived from intestine. 5. The method of claim 1, wherein the antibody or antigen binding fragment thereof that specifically binds TLR4 is administered in combination with one or more additional agents. 6. The method of claim 5, wherein the one or more additional agents is one or more immunosuppressive agents. 7. The method of claim 2, wherein the one or more additional agents is selected from methotrexate, cyclosporin A, tacrolimus, sirolimus, everolimus, a corticosteroid, anti-thymocyte globulin, Infliximab, Etanercept and Adalimumab. 8. The method of claim 1, wherein the antibody or antigen binding fragment thereof that specifically binds TLR4 is a monoclonal antibody, a mouse antibody, chimeric antibody, humanized antibody, fully human monoclonal antibody, domain antibody, single chain, F.sub.ab, F.sub.ab' or F.sub.(ab')2 fragments, scFvs, or an F.sub.ab expression library. |
Details for Patent 10,421,809
Applicant | Tradename | Biologic Ingredient | Dosage Form | BLA | Approval Date | Patent No. | Expiredate |
---|---|---|---|---|---|---|---|
Janssen Biotech, Inc. | REMICADE | infliximab | For Injection | 103772 | 08/24/1998 | ⤷ Try a Trial | 2031-01-10 |
Immunex Corporation | ENBREL | etanercept | For Injection | 103795 | 11/02/1998 | ⤷ Try a Trial | 2031-01-10 |
Immunex Corporation | ENBREL | etanercept | For Injection | 103795 | 05/27/1999 | ⤷ Try a Trial | 2031-01-10 |
Immunex Corporation | ENBREL | etanercept | Injection | 103795 | 09/27/2004 | ⤷ Try a Trial | 2031-01-10 |
>Applicant | >Tradename | >Biologic Ingredient | >Dosage Form | >BLA | >Approval Date | >Patent No. | >Expiredate |
Make Better Decisions: Try a trial or see plans & pricing
Drugs may be covered by multiple patents or regulatory protections. All trademarks and applicant names are the property of their respective owners or licensors. Although great care is taken in the proper and correct provision of this service, thinkBiotech LLC does not accept any responsibility for possible consequences of errors or omissions in the provided data. The data presented herein is for information purposes only. There is no warranty that the data contained herein is error free. thinkBiotech performs no independent verification of facts as provided by public sources nor are attempts made to provide legal or investing advice. Any reliance on data provided herein is done solely at the discretion of the user. Users of this service are advised to seek professional advice and independent confirmation before considering acting on any of the provided information. thinkBiotech LLC reserves the right to amend, extend or withdraw any part or all of the offered service without notice.